20% Discount on all orders above $200

LL-37 5mg

Cathelicidin Antimicrobial Peptide / Host Defense Research Standard

$90.00$75.00

Grade: Research Grade / Analytical Standard

Purity: ≥99% (HPLC Verified)

Format: Lyophilized (Freeze-Dried) Powder

Unit Size: 5 mg

Product Overview

LL-37 5mg (Leu-Leu-37) is a synthetic 37-amino acid amphipathic alpha-helical peptide representing the active, cleaved C-terminal domain of human cathelicidin antimicrobial protein (hCAP18). As a foundational component of the innate immune response, LL-37 exhibits potent broad-spectrum activity against Gram-positive and Gram-negative bacteria, viruses, and fungi by electrostatically targeting and permeabilizing microbial cell membranes.

Beyond direct pathogen clearance, LL-37 functions as a major immunomodulatory signaling molecule, orchestrating chemokine production, leukocyte recruitment, angiogenesis, and re-epithelialization. This 5mg format provides research facilities with a high-purity standard for evaluating host defense dynamics, lipopolysaccharide (LPS) endotoxin neutralization, biofilms, and tissue regeneration cascades in cell culture models.

Key Research Features & Highlights

  • Broad-Spectrum Antimicrobial Activity: Demonstrates high efficacy against diverse bacterial strains, fungi, and enveloped viruses via membrane disruption and pore formation.

  • LPS Endotoxin Neutralization: Directly binds lipopolysaccharide molecules, suppressing TLR4 receptor activation and downstream septic inflammatory cascades.

  • Biofilm Disruption & Clearance: Widely studied for its capacity to inhibit bacterial biofilm formation and disrupt established extracellular polymeric substance (EPS) matrices.

  • Innate Immune & Angiogenic Signaling: Serves as a primary reference tool for analyzing FPRL-1 (Formyl Peptide Receptor-Like 1) activation, endothelial sprouting, and chemotaxis.

  • Analytical Grade Purity (≥99%): Independently batch-tested via High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS) to guarantee high experimental repeatability.

Primary Applications in Laboratory Research

  • Pathogen-Host Interaction & Membrane Biophysics: Investigating carpet-model lipid bilayer permeabilization, transmembrane pore kinetics, and bacterial lysis.

  • Biofilm Suppression & Eradication: Studying the inhibition of bacterial adherence, quorumsensing pathways, and EPS matrix breakdown in resistant strains.

  • Immunomodulation & Cytokine Cascade Regulation: Evaluating FPRL-1 signaling, chemotactic migration of neutrophils and monocytes, and balanced inflammatory responses.

  • Wound Healing & Angiogenesis Assays: Researching keratinocyte migration, re-epithelialization acceleration, and vascular network expansion in vitro.

Product Specifications

Attribute

Specification

Active Compound

LL-37 (Human Cathelicidin Fragment hCAP18)

Net Quantity

5 mg

Form

Lyophilized White Powder

CAS Number

154947-66-7

Molecular Mass

~4493.30 g/mol

Sequence

[LL-37, 37 aa]

Purity Standard

≥99% (HPLC verified)

Solubility

Soluble in Water, PBS, or Sterile Deionized Water

Storage & Handling Protocols

  • Unreconstituted (Lyophilized): Store frozen at or below -20°C in a dry, dark environment protected from heat, light, and humidity.

  • Reconstituted Solution: Maintain at 2°C – 8°C following dilution with sterile solvent (e.g., Sterile Water or PBS) and utilize within 30 days. Avoid repeated freeze-thaw cycles.

Mandatory Research & Legal Disclaimer

FOR LABORATORY RESEARCH USE ONLY. This compound is distributed exclusively for in vitro scientific research, educational, and analytical laboratory applications. It is not approved for human or animal consumption, medical therapy, diagnostic procedures, cosmetic application, or commercial drug formulation.